Lineage for d4hlzd_ (4hlz D:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2266925Protein Influenza hemagglutinin (stalk) [58066] (12 species)
    trimer
  7. 2266962Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2267231Domain d4hlzd_: 4hlz D: [240210]
    Other proteins in same PDB: d4hlza1, d4hlza2, d4hlzc1, d4hlzc2, d4hlze1, d4hlze2, d4hlzh1, d4hlzh2, d4hlzj1, d4hlzj2, d4hlzl1, d4hlzl2
    automated match to d2viub_
    complexed with edo, nag, so4

Details for d4hlzd_

PDB Entry: 4hlz (more details), 2.9 Å

PDB Description: crystal structure of fab c179 in complex with a h2n2 influenza virus hemagglutinin
PDB Compounds: (D:) hemagglutinin HA2

SCOPe Domain Sequences for d4hlzd_:

Sequence, based on SEQRES records: (download)

>d4hlzd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyeeesklnrne

Sequence, based on observed residues (ATOM records): (download)

>d4hlzd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
teavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkv
rmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyeeesklnrne

SCOPe Domain Coordinates for d4hlzd_:

Click to download the PDB-style file with coordinates for d4hlzd_.
(The format of our PDB-style files is described here.)

Timeline for d4hlzd_: