Class a: All alpha proteins [46456] (285 folds) |
Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) |
Family a.126.1.1: Serum albumin-like [48553] (2 proteins) |
Protein Serum albumin [48554] (1 species) duplication: consists of three domains of this fold |
Species Human (Homo sapiens) [TaxId:9606] [48555] (69 PDB entries) Uniprot P02768 29-596 |
Domain d4hgmb3: 4hgm B:389-492 [240203] Other proteins in same PDB: d4hgma_ complexed with ace, edo |
PDB Entry: 4hgm (more details), 2.34 Å
SCOPe Domain Sequences for d4hgmb3:
Sequence, based on SEQRES records: (download)
>d4hgmb3 a.126.1.1 (B:389-492) Serum albumin {Human (Homo sapiens) [TaxId: 9606]} kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsale
>d4hgmb3 a.126.1.1 (B:389-492) Serum albumin {Human (Homo sapiens) [TaxId: 9606]} kqncelfeqlgeyqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpcae dylsvvlnqlcvlhektpvsdrvtkccslvnrrpcfsale
Timeline for d4hgmb3: