SCOPe 2.04: Domain d4hgmb3: 4hgm B:389-492

Lineage for d4hgmb3 (4hgm B:389-492)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (69 PDB entries)
   Uniprot P02768 29-596

8. Domain d4hgmb3: 4hgm B:389-492 [240203]
   Other proteins in same PDB: d4hgma_
   complexed with ace, edo

Details for d4hgmb3

PDB Entry: 4hgm, 2.34 Å

PDB Description: shark ignar variable domain

PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d4hgmb3:

Sequence, based on SEQRES records:

>d4hgmb3 a.126.1.1 (B:389-492) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsale

Sequence, based on observed residues (ATOM records):

>d4hgmb3 a.126.1.1 (B:389-492) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeyqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpcae
dylsvvlnqlcvlhektpvsdrvtkccslvnrrpcfsale

Timeline for d4hgmb3:

• d4hgmb3 is new in SCOPe 2.04-stable
  
• d4hgmb3 appears in SCOPe 2.05
  
• d4hgmb3 appears in the current release, SCOPe 2.08