Lineage for d4h32l_ (4h32 L:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969580Protein Influenza hemagglutinin (stalk) [58066] (8 species)
    trimer
  7. 1969596Species Influenza A virus, different strains [TaxId:11320] [58067] (109 PDB entries)
  8. 1969697Domain d4h32l_: 4h32 L: [240194]
    Other proteins in same PDB: d4h32a_, d4h32c_, d4h32e_, d4h32g_, d4h32i_, d4h32k_
    automated match to d1rd8b_
    complexed with nag

Details for d4h32l_

PDB Entry: 4h32 (more details), 2.7 Å

PDB Description: the crystal structure of the hemagglutinin h17 derived the bat influenza a virus
PDB Compounds: (L:) Hemagglutinin

SCOPe Domain Sequences for d4h32l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h32l_ h.3.1.1 (L:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
agfieggwqgmidgwygyhhenqegsgyaadkeatqkavdaitnkvnsiidkmnsqfesn
ikefnrlelriqhlsdrvddalldiwsyntellvllenertldfhdanvknlfekvkaql
kdnaidegngcflllhkcnnscmddikngtykymdyreeshiekqkidgve

SCOPe Domain Coordinates for d4h32l_:

Click to download the PDB-style file with coordinates for d4h32l_.
(The format of our PDB-style files is described here.)

Timeline for d4h32l_: