Lineage for d4h32h_ (4h32 H:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2266925Protein Influenza hemagglutinin (stalk) [58066] (12 species)
    trimer
  7. 2266962Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2267071Domain d4h32h_: 4h32 H: [240192]
    Other proteins in same PDB: d4h32a1, d4h32a2, d4h32c1, d4h32c2, d4h32e1, d4h32e2, d4h32g1, d4h32g2, d4h32i1, d4h32i2, d4h32k1, d4h32k2
    automated match to d1rd8b_
    complexed with nag

Details for d4h32h_

PDB Entry: 4h32 (more details), 2.7 Å

PDB Description: the crystal structure of the hemagglutinin h17 derived the bat influenza a virus
PDB Compounds: (H:) Hemagglutinin

SCOPe Domain Sequences for d4h32h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h32h_ h.3.1.1 (H:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
agfieggwqgmidgwygyhhenqegsgyaadkeatqkavdaitnkvnsiidkmnsqfesn
ikefnrlelriqhlsdrvddalldiwsyntellvllenertldfhdanvknlfekvkaql
kdnaidegngcflllhkcnnscmddikngtykymdyreeshiekqkidgve

SCOPe Domain Coordinates for d4h32h_:

Click to download the PDB-style file with coordinates for d4h32h_.
(The format of our PDB-style files is described here.)

Timeline for d4h32h_: