Lineage for d4h32b_ (4h32 B:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1709414Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1709415Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1709416Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1709417Protein Influenza hemagglutinin (stalk) [58066] (7 species)
    trimer
  7. 1709420Species Influenza A virus, different strains [TaxId:11320] [58067] (95 PDB entries)
  8. 1709525Domain d4h32b_: 4h32 B: [240189]
    Other proteins in same PDB: d4h32a_, d4h32c_, d4h32e_, d4h32g_, d4h32i_, d4h32k_
    automated match to d1rd8b_
    complexed with nag

Details for d4h32b_

PDB Entry: 4h32 (more details), 2.7 Å

PDB Description: the crystal structure of the hemagglutinin h17 derived the bat influenza a virus
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4h32b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h32b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
ieggwqgmidgwygyhhenqegsgyaadkeatqkavdaitnkvnsiidkmnsqfesnike
fnrlelriqhlsdrvddalldiwsyntellvllenertldfhdanvknlfekvkaqlkdn
aidegngcflllhkcnnscmddikngtykymdyreeshiekqkidgve

SCOPe Domain Coordinates for d4h32b_:

Click to download the PDB-style file with coordinates for d4h32b_.
(The format of our PDB-style files is described here.)

Timeline for d4h32b_: