SCOPe 2.06: Domain d4gyvf1: 4gyv F:536-747

Lineage for d4gyvf1 (4gyv F:536-747)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
   multihelical; core: 5-helical bundle

4. Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families)
   automatically mapped to Pfam PF00621

5. Family a.87.1.0: automated matches [233075] (1 protein)
   not a true family

6. Protein automated matches [233076] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [234557] (1 PDB entry)

8. Domain d4gyvf1: 4gyv F:536-747 [240171]
   Other proteins in same PDB: d4gyva2, d4gyvb2, d4gyvc2, d4gyvd2, d4gyve2, d4gyvf2, d4gyvg2, d4gyvh2, d4gyvi2
   automated match to d4gyvb_

Details for d4gyvf1

PDB Entry: 4gyv, 2.9 Å

PDB Description: crystal structure of the dh domain of farp2

PDB Compounds: (F:) FERM, RhoGEF and pleckstrin domain-containing protein 2

SCOPe Domain Sequences for d4gyvf1:

Sequence; same for both SEQRES and ATOM records:

>d4gyvf1 a.87.1.0 (F:536-747) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
edeayfiakeilatertylkdlevitvwfrsvlikeeampaalmallfsnidpvyefhrg
flheveqrlalwegpssahlkgdhqrigdillrnmrqlkeftsyfqrhdevltelekatk
hckkleavykefelqkvcylplntfllkpvqrlvhyrlllsrlcahyspghrdyadchea
lkaitevttelqqsltrlenlqkltelqrdlv

Timeline for d4gyvf1:

• d4gyvf1 first appeared in SCOPe 2.04, called d4gyvf_
  
• d4gyvf1 was called d4gyvf_ in SCOPe 2.05
  
• d4gyvf1 appears in SCOPe 2.07
  
• d4gyvf1 appears in the current release, SCOPe 2.08