SCOPe 2.05: Domain d4gypd1: 4gyp D:6-136

Lineage for d4gypd1 (4gyp D:6-136)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (83 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [256278] (1 PDB entry)

8. Domain d4gypd1: 4gyp D:6-136 [240168]
   Other proteins in same PDB: d4gypa1, d4gypa2, d4gypb1, d4gypb2, d4gypc2, d4gypd2
   automated match to d3n6ha1
   complexed with cit, gol, mg, p6g, peg, so4

Details for d4gypd1

PDB Entry: 4gyp, 2.1 Å

PDB Description: crystal structure of the heterotetrameric complex of glucd and glucdrp from e. coli k-12 mg1655 (efi target efi-506058)

PDB Compounds: (D:) Glucarate dehydratase-related protein

SCOPe Domain Sequences for d4gypd1:

Sequence; same for both SEQRES and ATOM records:

>d4gypd1 d.54.1.0 (D:6-136) automated matches {Escherichia coli K-12 [TaxId: 83333]}
spvitdmkvipvaghdsmllniggahnayftrnivvltdnaghtgigeapggdviyqtlv
daipmvlgqevarlnkvvqqvhkgnqaadfdtfgkgawtfelrvnavaaleaalldllgk
alnvpvcellg

Timeline for d4gypd1:

• d4gypd1 first appeared in SCOPe 2.04
  
• d4gypd1 appears in SCOPe 2.06
  
• d4gypd1 appears in the current release, SCOPe 2.08