Lineage for d4g7hp2 (4g7h P:258-318)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695832Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) (S)
  5. 2695938Family a.4.13.0: automated matches [254211] (1 protein)
    not a true family
  6. 2695939Protein automated matches [254475] (4 species)
    not a true protein
  7. 2695947Species Thermus thermophilus HB8 [TaxId:300852] [255804] (3 PDB entries)
  8. 2695950Domain d4g7hp2: 4g7h P:258-318 [240150]
    Other proteins in same PDB: d4g7ha1, d4g7ha2, d4g7hb1, d4g7hb2, d4g7hc_, d4g7hd_, d4g7he_, d4g7hf1, d4g7hk1, d4g7hk2, d4g7hl1, d4g7hl2, d4g7hm_, d4g7hn_, d4g7ho_, d4g7hp1
    automated match to d1smyf1
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d4g7hp2

PDB Entry: 4g7h (more details), 2.9 Å

PDB Description: Crystal structure of Thermus thermophilus transcription initiation complex
PDB Compounds: (P:) RNA polymerase sigma factor

SCOPe Domain Sequences for d4g7hp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g7hp2 a.4.13.0 (P:258-318) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl
e

SCOPe Domain Coordinates for d4g7hp2:

Click to download the PDB-style file with coordinates for d4g7hp2.
(The format of our PDB-style files is described here.)

Timeline for d4g7hp2: