Class a: All alpha proteins [46456] (285 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (26 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [234425] (1 PDB entry) |
Domain d4fgwb2: 4fgw B:235-385 [240136] Other proteins in same PDB: d4fgwa1, d4fgwb1 automated match to d4fgwa2 |
PDB Entry: 4fgw (more details), 2.45 Å
SCOPe Domain Sequences for d4fgwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fgwb2 a.100.1.0 (B:235-385) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} vagisicgalknvvalgcgfveglgwgnnasaaiqrvglgeiirfgqmffpesreetyyq esagvadlittcaggrnvkvarlmatsgkdawecekellngqsaqglitckevhewletc gsvedfplfeavyqivynnypmknlpdmiee
Timeline for d4fgwb2: