Class b: All beta proteins [48724] (180 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.0: automated matches [191576] (1 protein) not a true family |
Protein automated matches [191011] (16 species) not a true protein |
Species Vaccinia virus [TaxId:10245] [256246] (5 PDB entries) |
Domain d4etqx_: 4etq X: [240121] Other proteins in same PDB: d4etqa1, d4etqa2, d4etqb1, d4etqb2, d4etqh1, d4etqh2, d4etql1, d4etql2 automated match to d1dmya_ complexed with cl, edo, gol, scn |
PDB Entry: 4etq (more details), 2.1 Å
SCOPe Domain Sequences for d4etqx_:
Sequence, based on SEQRES records: (download)
>d4etqx_ b.74.1.0 (X:) automated matches {Vaccinia virus [TaxId: 10245]} pqqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpney vlsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisifl qvldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsadav wiifptpinihsdqlskfrtllslsnhegkphyitenyrnpyklnddtevyysge
>d4etqx_ b.74.1.0 (X:) automated matches {Vaccinia virus [TaxId: 10245]} pqqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpney vlsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisifl qvldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsadav wiifptpinihsdqlskfrtllslhyitenyrnpyklnddtevyysge
Timeline for d4etqx_: