SCOPe 2.05: Domain d4e70b1: 4e70 B:993-1112

Lineage for d4e70b1 (4e70 B:993-1112)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (57 species)
   not a true protein

7. Species Linum nodiflorum [TaxId:407264] [234362] (3 PDB entries)

8. Domain d4e70b1: 4e70 B:993-1112 [240091]
   Other proteins in same PDB: d4e70a2, d4e70b2
   automated match to d4e70a1
   complexed with gol, n7i

Details for d4e70b1

PDB Entry: 4e70, 1.61 Å

PDB Description: Crystal Structure Analysis of Coniferyl Alcohol 9-O-Methyltransferase from Linum Nodiflorum in Complex with Coniferyl Alcohol

PDB Compounds: (B:) Coniferyl alcohol 9-O-methyltransferase

SCOPe Domain Sequences for d4e70b1:

Sequence, based on SEQRES records:

>d4e70b1 a.4.5.0 (B:993-1112) automated matches {Linum nodiflorum [TaxId: 407264]}
glvprgshmdaatavelldaqpqvwhhflgyinsmtlqcaleldiadvihrhghpiplnq
laaaleipqtkapflsrlmrmlvhlgyftqvitkpedenddvlpsywlaplsrlllkqnp

Sequence, based on observed residues (ATOM records):

>d4e70b1 a.4.5.0 (B:993-1112) automated matches {Linum nodiflorum [TaxId: 407264]}
glvphmdaatavelldaqpqvwhhflgyinsmtlqcaleldiadvihrhghpiplnqlaa
aleipqtkapflsrlmrmlvhlgyftqvitkpvlpsywlaplsrlllkqnp

Timeline for d4e70b1:

• d4e70b1 first appeared in SCOPe 2.04
  
• d4e70b1 appears in SCOPe 2.06
  
• d4e70b1 appears in the current release, SCOPe 2.08