Lineage for d4dk3b1 (4dk3 B:1-126)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024425Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries)
  8. 2024619Domain d4dk3b1: 4dk3 B:1-126 [240077]
    Other proteins in same PDB: d4dk3a2, d4dk3b2
    automated match to d4dk3a_
    protein/RNA complex

Details for d4dk3b1

PDB Entry: 4dk3 (more details), 2.76 Å

PDB Description: structure of editosome protein
PDB Compounds: (B:) single domain antibody VHH

SCOPe Domain Sequences for d4dk3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dk3b1 b.1.1.1 (B:1-126) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqaggslrlscaasgrtsslysmgwfrqapgkerefvaaisrngantyy
tdsvkgrftisrdnakntvelqmnslkpedtavyycaadrfptmevvtimtneydywgqg
tqvtvs

SCOPe Domain Coordinates for d4dk3b1:

Click to download the PDB-style file with coordinates for d4dk3b1.
(The format of our PDB-style files is described here.)

Timeline for d4dk3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dk3b2