Lineage for d4dhji_ (4dhj I:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1634067Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1634068Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1634821Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 1634822Protein automated matches [190230] (16 species)
    not a true protein
  7. 1634906Species Nematode (Caenorhabditis elegans) [TaxId:6239] [256233] (2 PDB entries)
  8. 1634910Domain d4dhji_: 4dhj I: [240061]
    Other proteins in same PDB: d4dhjb_, d4dhjc_, d4dhjd_, d4dhjf_, d4dhjg_, d4dhjh_, d4dhjj_, d4dhjk_, d4dhjm_, d4dhjn_
    automated match to d4i6la_

Details for d4dhji_

PDB Entry: 4dhj (more details), 2.35 Å

PDB Description: the structure of a ceotub1 ubiquitin aldehyde ubc13~ub complex
PDB Compounds: (I:) Ubiquitin thioesterase otubain-like

SCOPe Domain Sequences for d4dhji_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dhji_ d.3.1.0 (I:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
deqksvplvatlapfsilcaeydnetsaaflskatelsevygeiryirgdgncfyrailv
glieimlkdrarlekfiassrdwtrtlvelgfpdwtctdfcdffieflekihsgvhteea
vytilnddgsanyilmffrlitsaflkqnseeyapfidegmtvaqyceqeiepmwkdadh
lainslikaagtrvrieymdrtaapnggwhydipsddqqiapeitllyrpghydviykkd
s

SCOPe Domain Coordinates for d4dhji_:

Click to download the PDB-style file with coordinates for d4dhji_.
(The format of our PDB-style files is described here.)

Timeline for d4dhji_: