Lineage for d4dckc_ (4dck C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543030Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1543031Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 1543405Family b.42.1.0: automated matches [191477] (1 protein)
    not a true family
  6. 1543406Protein automated matches [190764] (2 species)
    not a true protein
  7. 1543409Species Human (Homo sapiens) [TaxId:9606] [187978] (4 PDB entries)
  8. 1543413Domain d4dckc_: 4dck C: [240049]
    Other proteins in same PDB: d4dckb_
    automated match to d2uusa_
    complexed with mg

Details for d4dckc_

PDB Entry: 4dck (more details), 2.2 Å

PDB Description: Crystal structure of the C-terminus of voltage-gated sodium channel in complex with FGF13 and CaM
PDB Compounds: (C:) Fibroblast growth factor 13

SCOPe Domain Sequences for d4dckc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dckc_ b.42.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqlkgivtklysrqgyhlqlqadgtidgtkdedstytlfnlipvglrvvaiqgvqtklyl
amnsegylytselftpeckfkesvfenyyvtyssmiyrqqqsgrgwylglnkegeimkgn
hvkknkpaahflpkplkvamykepslhd

SCOPe Domain Coordinates for d4dckc_:

Click to download the PDB-style file with coordinates for d4dckc_.
(The format of our PDB-style files is described here.)

Timeline for d4dckc_: