![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
![]() | Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) ![]() |
![]() | Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
![]() | Protein automated matches [254528] (17 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [255272] (6 PDB entries) |
![]() | Domain d4asuf3: 4asu F:358-474 [239993] Other proteins in same PDB: d4asua1, d4asua2, d4asua3, d4asub1, d4asub2, d4asub3, d4asuc1, d4asuc2, d4asuc3, d4asud1, d4asud2, d4asue1, d4asue2, d4asuf1, d4asuf2, d4asug_, d4asui_ automated match to d1mabb1 complexed with adp, mg |
PDB Entry: 4asu (more details), 2.6 Å
SCOPe Domain Sequences for d4asuf3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4asuf3 a.69.1.0 (F:358-474) automated matches {Cow (Bos taurus) [TaxId: 9913]} mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla
Timeline for d4asuf3: