Lineage for d4asue2 (4asu E:82-357)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2126370Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2126933Protein automated matches [190393] (10 species)
    not a true protein
  7. 2126957Species Cow (Bos taurus) [TaxId:9913] [255271] (6 PDB entries)
  8. 2126980Domain d4asue2: 4asu E:82-357 [239989]
    Other proteins in same PDB: d4asua1, d4asua2, d4asua3, d4asub1, d4asub2, d4asub3, d4asuc1, d4asuc2, d4asuc3, d4asud1, d4asud3, d4asue1, d4asue3, d4asuf1, d4asuf3, d4asug_, d4asui_
    automated match to d1mabb3
    complexed with adp, mg

Details for d4asue2

PDB Entry: 4asu (more details), 2.6 Å

PDB Description: F1-ATPase in which all three catalytic sites contain bound nucleotide, with magnesium ion released in the Empty site
PDB Compounds: (E:) ATP synthase subunit beta, mitochondrial

SCOPe Domain Sequences for d4asue2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4asue2 c.37.1.11 (E:82-357) automated matches {Cow (Bos taurus) [TaxId: 9913]}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

SCOPe Domain Coordinates for d4asue2:

Click to download the PDB-style file with coordinates for d4asue2.
(The format of our PDB-style files is described here.)

Timeline for d4asue2: