Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (29 species) not a true protein |
Species Influenza A virus, different strains [TaxId:11320] [255822] (26 PDB entries) |
Domain d3zp1f_: 3zp1 F: [239962] Other proteins in same PDB: d3zp1e_ automated match to d2fk0b1 |
PDB Entry: 3zp1 (more details), 2.6 Å
SCOPe Domain Sequences for d3zp1f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zp1f_ h.3.1.1 (F:) automated matches {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrlqlrdnakelgngcfefyhkcdnecmesvrngtyd
Timeline for d3zp1f_: