Lineage for d3zlfd2 (3zlf D:140-433)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837793Species Streptococcus pyogenes [TaxId:286636] [236667] (3 PDB entries)
  8. 2837801Domain d3zlfd2: 3zlf D:140-433 [239944]
    Other proteins in same PDB: d3zlfa1, d3zlfa3, d3zlfb1, d3zlfb3, d3zlfc1, d3zlfc3, d3zlfd1, d3zlfd3
    automated match to d3zlfb2
    complexed with po4; mutant

Details for d3zlfd2

PDB Entry: 3zlf (more details), 2.15 Å

PDB Description: structure of group a streptococcal enolase k312a mutant
PDB Compounds: (D:) enolase

SCOPe Domain Sequences for d3zlfd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zlfd2 c.1.11.0 (D:140-433) automated matches {Streptococcus pyogenes [TaxId: 286636]}
kvlptpmmniinggshsdapiafqefmimpvgaptfkeglrwgaevfhalkkilkerglv
tavgdeggfapkfegtedgvetilkaieaagyeagengimigfdcassefydkerkvydy
tkfegegaavrtsaeqvdyleelvnkypiitiedgmdendwdgwkvlterlgarvqlvgd
dffvtnteylargikenaansilikvnqigtltetfeaiemakeagytavvshrsgeted
stiadiavatnagqiktgslsrtdriakynqllriedqlgevaqykgiksfynl

SCOPe Domain Coordinates for d3zlfd2:

Click to download the PDB-style file with coordinates for d3zlfd2.
(The format of our PDB-style files is described here.)

Timeline for d3zlfd2: