SCOPe 2.08: Domain d3wd7b2: 3wd7 B:236-389

Lineage for d3wd7b2 (3wd7 B:236-389)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Citrus microcarpa [TaxId:164113] [227815] (2 PDB entries)

8. Domain d3wd7b2: 3wd7 B:236-389 [239910]
   Other proteins in same PDB: d3wd7a3, d3wd7b3
   automated match to d3wd7a2
   complexed with coa, ni, so4

Details for d3wd7b2

PDB Entry: 3wd7, 2.35 Å

PDB Description: Type III polyketide synthase

PDB Compounds: (B:) Type III polyketide synthases acridone synthase

SCOPe Domain Sequences for d3wd7b2:

Sequence; same for both SEQRES and ATOM records:

>d3wd7b2 c.95.1.0 (B:236-389) automated matches {Citrus microcarpa [TaxId: 164113]}
lyhivsasqtllpdsdgaieghireagltvhlkkdvpeffsaniekslvdaftpigisdw
nsifwiahpggpaildqveaklglkkdklrasrhvmseygnmssacvlfildemrnkcle
egkattgegldwgvlfgfgpgltvetvvlhslpi

Timeline for d3wd7b2:

• d3wd7b2 first appeared in SCOPe 2.04
  
• d3wd7b2 appears in SCOPe 2.07