Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
Protein automated matches [227006] (4 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [233826] (5 PDB entries) |
Domain d3v62e2: 3v62 E:127-255 [239891] Other proteins in same PDB: d3v62a_, d3v62d_ automated match to d3v60b2 protein/DNA complex; complexed with neq, so4 |
PDB Entry: 3v62 (more details), 2.9 Å
SCOPe Domain Sequences for d3v62e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v62e2 d.131.1.2 (E:127-255) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsviikpfv dmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgfl qfflapkfn
Timeline for d3v62e2:
View in 3D Domains from other chains: (mouse over for more information) d3v62a_, d3v62b1, d3v62b2, d3v62d_ |