SCOPe 2.04: Domain d3v5wa1: 3v5w A:30-185

Lineage for d3v5wa1 (3v5w A:30-185)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.0: automated matches [191379] (1 protein)
   not a true family

6. Protein automated matches [190464] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187381] (25 PDB entries)

8. Domain d3v5wa1: 3v5w A:30-185 [239885]
   Other proteins in same PDB: d3v5wa2, d3v5wa3, d3v5wb_, d3v5wg_
   automated match to d1omwa1
   complexed with 8pr, mg

Details for d3v5wa1

PDB Entry: 3v5w, 2.07 Å

PDB Description: Human G Protein-Coupled Receptor Kinase 2 in Complex with Soluble Gbetagamma Subunits and Paroxetine

PDB Compounds: (A:) g-protein coupled receptor kinase 2

SCOPe Domain Sequences for d3v5wa1:

Sequence; same for both SEQRES and ATOM records:

>d3v5wa1 a.91.1.0 (A:30-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclnhleearplvefyeei
kkyekleteeervarsreifdsyimkellacshpfsksatehvqghlgkkqvppdlfqpy
ieeicqnlrgdvfqkfiesdkftrfcqwknvelnih

Timeline for d3v5wa1:

• d3v5wa1 is new in SCOPe 2.04-stable
  
• d3v5wa1 appears in SCOPe 2.05
  
• d3v5wa1 appears in the current release, SCOPe 2.08