SCOPe 2.06: Domain d3uzec1: 3uze C:299-395

Lineage for d3uzec1 (3uze C:299-395)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)

6. Protein automated matches [190183] (7 species)
   not a true protein

7. Species Dengue virus 3 [TaxId:11069] [195240] (2 PDB entries)

8. Domain d3uzec1: 3uze C:299-395 [239884]
   Other proteins in same PDB: d3uzea1, d3uzea2, d3uzeb1, d3uzeb2, d3uzec2
   automated match to d1pjwa_
   complexed with edo, epe, gol

Details for d3uzec1

PDB Entry: 3uze, 2.04 Å

PDB Description: Crystal structure of the dengue virus serotype 3 envelope protein domain III in complex with the variable domains of Mab 4E11

PDB Compounds: (C:) envelope protein

SCOPe Domain Sequences for d3uzec1:

Sequence, based on SEQRES records:

>d3uzec1 b.1.18.4 (C:299-395) automated matches {Dengue virus 3 [TaxId: 11069]}
yamclntfvlkkevsetqhgtilikveykgedapckipfstedgqgkahngrlitanpvv
tkkeepvnieaeppfgesnivigigdkalkinwyrkg

Sequence, based on observed residues (ATOM records):

>d3uzec1 b.1.18.4 (C:299-395) automated matches {Dengue virus 3 [TaxId: 11069]}
yamclntfvlkkevsehgtilikveykgedapckipfstedgqgkahngrlitanpvvtk
kvnieaeppfgesnivigigdkalkinwyrkg

Timeline for d3uzec1:

• d3uzec1 first appeared in SCOPe 2.04, called d3uzec_
  
• d3uzec1 was called d3uzec_ in SCOPe 2.05
  
• d3uzec1 appears in SCOPe 2.07
  
• d3uzec1 appears in the current release, SCOPe 2.08