SCOPe 2.08: Domain d3uset_: 3use T:

Lineage for d3uset_ (3use T:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
   2 domains: (1) alpa/beta; (2) Fe-S cluster-bound

4. Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families)

5. Family e.19.1.0: automated matches [191636] (1 protein)
   not a true family

6. Protein automated matches [191172] (11 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [256126] (6 PDB entries)

8. Domain d3uset_: 3use T: [239878]
   Other proteins in same PDB: d3usel_, d3usem_
   automated match to d3ayxb_
   complexed with 3ni, cl, f3s, f4s, fco, gol, li, lmt, mg, sf3, sf4, so4

Details for d3uset_

PDB Entry: 3use, 1.67 Å

PDB Description: Crystal Structure of E. coli hydrogenase-1 in its as-isolated form

PDB Compounds: (T:) Hydrogenase-1 small chain

SCOPe Domain Sequences for d3uset_:

Sequence; same for both SEQRES and ATOM records:

>d3uset_ e.19.1.0 (T:) automated matches {Escherichia coli [TaxId: 562]}
kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi
itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa
arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg
qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpi
qsghgclgcaengfwdrgsfysrvvdip

Timeline for d3uset_:

• d3uset_ first appeared in SCOPe 2.04
  
• d3uset_ appears in SCOPe 2.07