SCOPe 2.08: Domain d3un8t_: 3un8 T:

Lineage for d3un8t_ (3un8 T:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.0: automated matches [191393] (1 protein)
   not a true family

6. Protein automated matches [190509] (19 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)

8. Domain d3un8t_: 3un8 T: [239872]
   Other proteins in same PDB: d3un8a_, d3un8b_, d3un8c1, d3un8c2, d3un8d_, d3un8e_, d3un8g_, d3un8h_, d3un8i_, d3un8j_, d3un8k_, d3un8l_, d3un8m_, d3un8n_, d3un8o_, d3un8p_, d3un8q1, d3un8q2, d3un8r_, d3un8s_, d3un8u_, d3un8v_, d3un8w_, d3un8x_, d3un8y_, d3un8z_
   automated match to d1irug_
   complexed with 049

Details for d3un8t_

PDB Entry: 3un8, 2.7 Å

PDB Description: Yeast 20S proteasome in complex with PR-957 (epoxide)

PDB Compounds: (T:) Proteasome component C1

SCOPe Domain Sequences for d3un8t_:

Sequence; same for both SEQRES and ATOM records:

>d3un8t_ d.153.1.0 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
kein

Timeline for d3un8t_:

• d3un8t_ first appeared in SCOPe 2.04
  
• d3un8t_ appears in SCOPe 2.07