Lineage for d3ubnf_ (3ubn F:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1709414Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1709415Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1709416Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1709744Protein automated matches [254646] (27 species)
    not a true protein
  7. 1709857Species Influenza A virus [TaxId:641501] [255945] (7 PDB entries)
  8. 1709881Domain d3ubnf_: 3ubn F: [239860]
    Other proteins in same PDB: d3ubna_, d3ubnc_, d3ubne_, d3ubng_, d3ubni_, d3ubnk_
    automated match to d4n5zb_
    complexed with nag

Details for d3ubnf_

PDB Entry: 3ubn (more details), 2.51 Å

PDB Description: influenza hemagglutinin from the 2009 pandemic in complex with ligand 6sln
PDB Compounds: (F:) hemagglutinin HA2

SCOPe Domain Sequences for d3ubnf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ubnf_ h.3.1.1 (F:) automated matches {Influenza A virus [TaxId: 641501]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnr

SCOPe Domain Coordinates for d3ubnf_:

Click to download the PDB-style file with coordinates for d3ubnf_.
(The format of our PDB-style files is described here.)

Timeline for d3ubnf_: