Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (27 species) not a true protein |
Species Influenza A virus [TaxId:641501] [255945] (7 PDB entries) |
Domain d3ubnf_: 3ubn F: [239860] Other proteins in same PDB: d3ubna_, d3ubnc_, d3ubne_, d3ubng_, d3ubni_, d3ubnk_ automated match to d4n5zb_ complexed with nag |
PDB Entry: 3ubn (more details), 2.51 Å
SCOPe Domain Sequences for d3ubnf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ubnf_ h.3.1.1 (F:) automated matches {Influenza A virus [TaxId: 641501]} glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnr
Timeline for d3ubnf_: