SCOPe 2.06: Domain d3ubjb_: 3ubj B:

Lineage for d3ubjb_ (3ubj B:)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (34 species)
   not a true protein

7. Species Influenza A virus [TaxId:641501] [255945] (7 PDB entries)

8. Domain d3ubjb_: 3ubj B: [239852]
   Other proteins in same PDB: d3ubja_, d3ubjc_, d3ubje1, d3ubje2, d3ubjg_, d3ubji_, d3ubjk_
   automated match to d4n5zb_
   complexed with nag

Details for d3ubjb_

PDB Entry: 3ubj, 2.25 Å

PDB Description: influenza hemagglutinin from the 2009 pandemic in complex with ligand lsta

PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d3ubjb_:

Sequence; same for both SEQRES and ATOM records:

>d3ubjb_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 641501]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeakln

Timeline for d3ubjb_:

• d3ubjb_ first appeared in SCOPe 2.04
  
• d3ubjb_ appears in SCOPe 2.05
  
• d3ubjb_ appears in SCOPe 2.07
  
• d3ubjb_ appears in the current release, SCOPe 2.08