Lineage for d3ubjb_ (3ubj B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041640Species Influenza A virus [TaxId:641501] [255945] (7 PDB entries)
  8. 3041656Domain d3ubjb_: 3ubj B: [239852]
    Other proteins in same PDB: d3ubja_, d3ubjc_, d3ubje1, d3ubje2, d3ubjg_, d3ubji_, d3ubjk_
    automated match to d4n5zb_
    complexed with nag

Details for d3ubjb_

PDB Entry: 3ubj (more details), 2.25 Å

PDB Description: influenza hemagglutinin from the 2009 pandemic in complex with ligand lsta
PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d3ubjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ubjb_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 641501]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeakln

SCOPe Domain Coordinates for d3ubjb_:

Click to download the PDB-style file with coordinates for d3ubjb_.
(The format of our PDB-style files is described here.)

Timeline for d3ubjb_: