Lineage for d3ubeh_ (3ube H:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2267375Protein automated matches [254646] (34 species)
    not a true protein
  7. 2267628Species Influenza A virus [TaxId:641501] [255945] (7 PDB entries)
  8. 2267638Domain d3ubeh_: 3ube H: [239849]
    Other proteins in same PDB: d3ubea_, d3ubec_, d3ubee_, d3ubeg_, d3ubei_, d3ubek1, d3ubek2
    automated match to d4n5zb_
    complexed with nag, sia

Details for d3ubeh_

PDB Entry: 3ube (more details), 2.15 Å

PDB Description: influenza hemagglutinin from the 2009 pandemic in complex with ligand lstc
PDB Compounds: (H:) hemagglutinin HA2

SCOPe Domain Sequences for d3ubeh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ubeh_ h.3.1.1 (H:) automated matches {Influenza A virus [TaxId: 641501]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnr

SCOPe Domain Coordinates for d3ubeh_:

Click to download the PDB-style file with coordinates for d3ubeh_.
(The format of our PDB-style files is described here.)

Timeline for d3ubeh_: