Class a: All alpha proteins [46456] (289 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.0: automated matches [191623] (1 protein) not a true family |
Protein automated matches [191142] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189274] (54 PDB entries) |
Domain d3tx7b_: 3tx7 B: [239838] Other proteins in same PDB: d3tx7a_ automated match to d2xhsa_ complexed with p6l |
PDB Entry: 3tx7 (more details), 2.76 Å
SCOPe Domain Sequences for d3tx7b_:
Sequence, based on SEQRES records: (download)
>d3tx7b_ a.123.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} asiphlilellkcepdepqvqakimaylqqeqanrskheklstfglmckmadqtlfsive warssiffrelkvddqmkllqncwsellildhiyrqvvhgkegsiflvtgqqvdysiias qagatlnnlmshaqelvaklrslqfdqrefvclkflvlfsldvknlenfqlvegvqeqvn aalldytmcnypqqtekfgqlllrlpeiraismqaeeylyykhlngdvpynnlliemlha
>d3tx7b_ a.123.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} asiphlilellkcepdepqvqakimaylqqeqaklstfglmckmadqtlfsivewarssq mkllqncwsellildhiyrqvvhgkegsiflvtgqqvdysiiasqagatlnnlmshaqel vaklrslqfdqrefvclkflvlfsldvqlvegvqeqvnaalldytmcnypqqtekfgqll lrlpeiraismqaeeylyykhlngdvpynnlliemlha
Timeline for d3tx7b_: