Lineage for d3tria2 (3tri A:163-273)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1498032Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1498033Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1498233Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 1498234Protein automated matches [226851] (26 species)
    not a true protein
  7. 1498252Species Coxiella burnetii [TaxId:777] [233715] (1 PDB entry)
  8. 1498253Domain d3tria2: 3tri A:163-273 [239812]
    Other proteins in same PDB: d3tria1, d3trib1
    automated match to d3trib2
    complexed with cl, nap, po4

Details for d3tria2

PDB Entry: 3tri (more details), 2.5 Å

PDB Description: structure of a pyrroline-5-carboxylate reductase (proc) from coxiella burnetii
PDB Compounds: (A:) pyrroline-5-carboxylate reductase

SCOPe Domain Sequences for d3tria2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tria2 a.100.1.0 (A:163-273) automated matches {Coxiella burnetii [TaxId: 777]}
sedqiekiaalsgsgpayiflimealqeaaeqlgltketaellteqtvlgaarmaleteq
svvqlrqfvtspggtteqaikvlesgnlrelfikaltaavnrakelsktvd

SCOPe Domain Coordinates for d3tria2:

Click to download the PDB-style file with coordinates for d3tria2.
(The format of our PDB-style files is described here.)

Timeline for d3tria2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tria1