SCOPe 2.07: Domain d3th4l3: 3th4 L:87-142

Lineage for d3th4l3 (3th4 L:87-142)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein automated matches [190092] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187310] (72 PDB entries)

8. Domain d3th4l3: 3th4 L:87-142 [239810]
   Other proteins in same PDB: d3th4h_, d3th4l1, d3th4l2, d3th4t1, d3th4t2
   automated match to d2a2ql2
   complexed with 0ge, bgc, ca, cl, fuc, mg, na

Details for d3th4l3

PDB Entry: 3th4, 1.8 Å

PDB Description: mg2+ is required for optimal folding of the gamma-carboxyglutamic acid (gla) domains of vitamin k-dependent clotting factors at physiological ca2+

PDB Compounds: (L:) Coagulation factor VII light chain

SCOPe Domain Sequences for d3th4l3:

Sequence; same for both SEQRES and ATOM records:

>d3th4l3 g.3.11.1 (L:87-142) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile

Timeline for d3th4l3:

• d3th4l3 first appeared in SCOPe 2.04
  
• d3th4l3 appears in SCOPe 2.06
  
• d3th4l3 appears in the current release, SCOPe 2.08