Class g: Small proteins [56992] (98 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein automated matches [190092] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187310] (72 PDB entries) |
Domain d3th4l3: 3th4 L:87-142 [239810] Other proteins in same PDB: d3th4h_, d3th4l1, d3th4l2, d3th4t1, d3th4t2 automated match to d2a2ql2 complexed with 0ge, bgc, ca, cl, fuc, mg, na |
PDB Entry: 3th4 (more details), 1.8 Å
SCOPe Domain Sequences for d3th4l3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3th4l3 g.3.11.1 (L:87-142) automated matches {Human (Homo sapiens) [TaxId: 9606]} dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile
Timeline for d3th4l3: