Lineage for d3th2l2 (3th2 L:49-86)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1700389Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1701322Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1701902Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 1701903Protein automated matches [226968] (2 species)
    not a true protein
  7. 1701904Species Human (Homo sapiens) [TaxId:9606] [225423] (21 PDB entries)
  8. 1701905Domain d3th2l2: 3th2 L:49-86 [239806]
    Other proteins in same PDB: d3th2h_, d3th2l1, d3th2l3, d3th2t1, d3th2t2
    automated match to d2a2ql1
    complexed with ben, bgc, ca, cl, fuc, mg, na

Details for d3th2l2

PDB Entry: 3th2 (more details), 1.72 Å

PDB Description: mg2+ is required for optimal folding of the gamma-carboxyglutamic acid (gla) domains of vitamin k-dependent clotting factors at physiological ca2+
PDB Compounds: (L:) Coagulation factor VII light chain

SCOPe Domain Sequences for d3th2l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3th2l2 g.3.11.0 (L:49-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcasspcqnggsckdqlqsyicfclpafegrncethkd

SCOPe Domain Coordinates for d3th2l2:

Click to download the PDB-style file with coordinates for d3th2l2.
(The format of our PDB-style files is described here.)

Timeline for d3th2l2: