Class g: Small proteins [56992] (91 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.0: automated matches [227227] (1 protein) not a true family |
Protein automated matches [226968] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225423] (21 PDB entries) |
Domain d3th2l2: 3th2 L:49-86 [239806] Other proteins in same PDB: d3th2h_, d3th2l1, d3th2l3, d3th2t1, d3th2t2 automated match to d2a2ql1 complexed with ben, bgc, ca, cl, fuc, mg, na |
PDB Entry: 3th2 (more details), 1.72 Å
SCOPe Domain Sequences for d3th2l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3th2l2 g.3.11.0 (L:49-86) automated matches {Human (Homo sapiens) [TaxId: 9606]} qcasspcqnggsckdqlqsyicfclpafegrncethkd
Timeline for d3th2l2: