Lineage for d3t6dh1 (3t6d H:1-36)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2578573Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) (S)
  5. 2578693Family f.23.10.0: automated matches [227192] (1 protein)
    not a true family
  6. 2578694Protein automated matches [226917] (3 species)
    not a true protein
  7. 2578695Species Blastochloris viridis [TaxId:1079] [232250] (5 PDB entries)
  8. 2578696Domain d3t6dh1: 3t6d H:1-36 [239791]
    Other proteins in same PDB: d3t6dc_, d3t6dh2, d3t6dl_, d3t6dm_
    automated match to d3g7fh1
    complexed with bcb, bpb, dga, fe2, gol, hec, hth, hto, lda, mq9, ns5, so4, uq9

Details for d3t6dh1

PDB Entry: 3t6d (more details), 1.95 Å

PDB Description: Crystal Structure of the Reaction Centre from Blastochloris viridis strain DSM 133 (ATCC 19567) substrain-08
PDB Compounds: (H:) Photosynthetic reaction center H-subunit

SCOPe Domain Sequences for d3t6dh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t6dh1 f.23.10.0 (H:1-36) automated matches {Blastochloris viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

SCOPe Domain Coordinates for d3t6dh1:

Click to download the PDB-style file with coordinates for d3t6dh1.
(The format of our PDB-style files is described here.)

Timeline for d3t6dh1: