SCOPe 2.08: Domain d3sufb_: 3suf B:

Lineage for d3sufb_ (3suf B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein automated matches [190658] (12 species)
   not a true protein

7. Species Hepatitis C virus subtype 1a [TaxId:31646] [226463] (22 PDB entries)

8. Domain d3sufb_: 3suf B: [239778]
   automated match to d3sufa_
   complexed with so4, sue, zn

Details for d3sufb_

PDB Entry: 3suf, 2.19 Å

PDB Description: crystal structure of ns3/4a protease variant d168a in complex with mk- 5172

PDB Compounds: (B:) NS3 protease, NS4A protein

SCOPe Domain Sequences for d3sufb_:

Sequence; same for both SEQRES and ATOM records:

>d3sufb_ b.47.1.3 (B:) automated matches {Hepatitis C virus subtype 1a [TaxId: 31646]}
gsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivstatqtflatsin
gvlwtvyhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdlylvtr
hadvipvrrrgdsrgsllsprpisylkgssggpllcpaghavgifraavctrgvakavaf
ipveslettm

Timeline for d3sufb_:

• d3sufb_ first appeared in SCOPe 2.04
  
• d3sufb_ appears in SCOPe 2.07