Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries) |
Domain d3sdlc1: 3sdl C:4-78 [239724] Other proteins in same PDB: d3sdla_, d3sdlb_, d3sdlc2, d3sdld2 automated match to d3r66c1 |
PDB Entry: 3sdl (more details), 2.29 Å
SCOPe Domain Sequences for d3sdlc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sdlc1 d.15.1.0 (C:4-78) automated matches {Human (Homo sapiens) [TaxId: 9606]} dltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgvalqdrvplasq glgpgstvllvvdkc
Timeline for d3sdlc1:
View in 3D Domains from other chains: (mouse over for more information) d3sdla_, d3sdlb_, d3sdld1, d3sdld2 |