SCOPe 2.06: Domain d3sdkp_: 3sdk P:

Lineage for d3sdkp_ (3sdk P:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (11 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)

8. Domain d3sdkp_: 3sdk P: [239722]
   Other proteins in same PDB: d3sdk1_, d3sdk2_, d3sdka_, d3sdkc_, d3sdke_, d3sdkf_, d3sdkg_, d3sdkh_, d3sdki_, d3sdkj_, d3sdkk_, d3sdkl_, d3sdkm_, d3sdkn_, d3sdko_, d3sdkq_, d3sdks_, d3sdkt_, d3sdku_, d3sdkv_, d3sdkw_, d3sdkx_, d3sdky_, d3sdkz_
   automated match to d3oeub_
   complexed with mes, mg, p3n

Details for d3sdkp_

PDB Entry: 3sdk, 2.7 Å

PDB Description: structure of yeast 20s open-gate proteasome with compound 34

PDB Compounds: (P:) Proteasome component Y13

SCOPe Domain Sequences for d3sdkp_:

Sequence; same for both SEQRES and ATOM records:

>d3sdkp_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdtsteklykln
dkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqgytqhgglrp
fgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdykddmkvddai
elalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvktgit

Timeline for d3sdkp_:

• d3sdkp_ first appeared in SCOPe 2.04
  
• d3sdkp_ appears in SCOPe 2.05
  
• d3sdkp_ appears in SCOPe 2.07
  
• d3sdkp_ appears in the current release, SCOPe 2.08