SCOPe 2.05: Domain d3sdif_: 3sdi F:

Lineage for d3sdif_ (3sdi F:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (7 species)
   contains an extension to the common fold at the N-terminus

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (76 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d3sdif_: 3sdi F: [239717]
   Other proteins in same PDB: d3sdi1_, d3sdi2_, d3sdia_, d3sdib_, d3sdic_, d3sdid_, d3sdig_, d3sdih_, d3sdii_, d3sdij_, d3sdik_, d3sdil_, d3sdim_, d3sdin_, d3sdio_, d3sdip_, d3sdiq_, d3sdir_, d3sdiu_, d3sdiv_, d3sdiw_, d3sdix_, d3sdiy_, d3sdiz_
   automated match to d3oeuf_
   complexed with 3sd, mes, mg

Details for d3sdif_

PDB Entry: 3sdi, 2.65 Å

PDB Description: structure of yeast 20s open-gate proteasome with compound 20

PDB Compounds: (F:) Proteasome component C1

SCOPe Domain Sequences for d3sdif_:

Sequence; same for both SEQRES and ATOM records:

>d3sdif_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknvk
iqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtly
nsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpeg
lsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqke
in

Timeline for d3sdif_:

• d3sdif_ first appeared in SCOPe 2.04
  
• d3sdif_ appears in SCOPe 2.06
  
• d3sdif_ appears in the current release, SCOPe 2.08