Lineage for d3s11d_ (3s11 D:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645931Protein automated matches [254646] (36 species)
    not a true protein
  7. 2646215Species Influenza A virus, different strains [TaxId:11320] [255822] (42 PDB entries)
  8. 2646231Domain d3s11d_: 3s11 D: [239709]
    Other proteins in same PDB: d3s11a1, d3s11a2, d3s11c1, d3s11c2, d3s11e1, d3s11e2
    automated match to d4n5zb_
    complexed with gol, nag, tam

Details for d3s11d_

PDB Entry: 3s11 (more details), 2.5 Å

PDB Description: crystal structure of h5n1 influenza virus hemagglutinin, strain 437-10
PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d3s11d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s11d_ h.3.1.1 (D:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnree

SCOPe Domain Coordinates for d3s11d_:

Click to download the PDB-style file with coordinates for d3s11d_.
(The format of our PDB-style files is described here.)

Timeline for d3s11d_: