Lineage for d3rsjd2 (3rsj D:1086-1278)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2062236Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2062365Family b.42.4.0: automated matches [191368] (1 protein)
    not a true family
  6. 2062366Protein automated matches [190445] (6 species)
    not a true protein
  7. 2062372Species Clostridium botulinum [TaxId:1491] [225676] (22 PDB entries)
  8. 2062386Domain d3rsjd2: 3rsj D:1086-1278 [239702]
    Other proteins in same PDB: d3rsja1, d3rsjb1, d3rsjc1, d3rsjd1
    automated match to d3rsja2

Details for d3rsjd2

PDB Entry: 3rsj (more details), 2 Å

PDB Description: structure of hcrf in complex with ganglioside gd1a
PDB Compounds: (D:) BoNT/F

SCOPe Domain Sequences for d3rsjd2:

Sequence, based on SEQRES records: (download)

>d3rsjd2 b.42.4.0 (D:1086-1278) automated matches {Clostridium botulinum [TaxId: 1491]}
dpsilkdfwgnyllynkryyllnllrtdksitqnsnflninqqrgvyqkpnifsntrlyt
gveviirkngstdisntdnfvrkndlayinvvdrdveyrlyadisiakpekiiklirtsn
snnslgqiivmdsignnctmnfqnnnggnigllgfhsnnlvasswyynnirkntssngcf
wsfiskehgwqen

Sequence, based on observed residues (ATOM records): (download)

>d3rsjd2 b.42.4.0 (D:1086-1278) automated matches {Clostridium botulinum [TaxId: 1491]}
dpsilkdfwgnyllynkryyllnllrtdksitqnsnflninqqrgvyqkpnifsntrlyt
gveviirknntdnfvrkndlayinvvdrdveyrlyadisiakpekiiklirtnnslgqii
vmdsignnctmnfqnnnggnigllgfhsnnlvasswyynnirkntssngcfwsfiskehg
wqen

SCOPe Domain Coordinates for d3rsjd2:

Click to download the PDB-style file with coordinates for d3rsjd2.
(The format of our PDB-style files is described here.)

Timeline for d3rsjd2: