Lineage for d3r5xb2 (3r5x B:1-93)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2862050Family c.30.1.2: D-Alanine ligase N-terminal domain [52452] (2 proteins)
  6. 2862051Protein D-Ala-D-Ala ligase, N-domain [52453] (3 species)
  7. 2862052Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [256401] (1 PDB entry)
  8. 2862054Domain d3r5xb2: 3r5x B:1-93 [239684]
    Other proteins in same PDB: d3r5xa1, d3r5xa3, d3r5xb1, d3r5xb3, d3r5xc1, d3r5xc3, d3r5xd1, d3r5xd3
    complexed with acy, atp, ca, edo, mg

Details for d3r5xb2

PDB Entry: 3r5x (more details), 2 Å

PDB Description: crystal structure of d-alanine--d-alanine ligase from bacillus anthracis complexed with atp
PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d3r5xb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r5xb2 c.30.1.2 (B:1-93) D-Ala-D-Ala ligase, N-domain {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mrigvimggvssekqvsimtgnemianldknkyeivpitlnekmdliekakdidfallal
hgkygedgtvqgtleslgipysgsnmlssgicm

SCOPe Domain Coordinates for d3r5xb2:

Click to download the PDB-style file with coordinates for d3r5xb2.
(The format of our PDB-style files is described here.)

Timeline for d3r5xb2: