Lineage for d3r23b2 (3r23 B:0-93)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1842743Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 1842744Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 1842922Family c.30.1.2: D-Alanine ligase N-terminal domain [52452] (2 proteins)
  6. 1842923Protein D-Ala-D-Ala ligase, N-domain [52453] (3 species)
  7. 1842929Species Bacillus anthracis [TaxId:198094] [256400] (1 PDB entry)
  8. 1842931Domain d3r23b2: 3r23 B:0-93 [239679]
    Other proteins in same PDB: d3r23a1, d3r23b1
    complexed with edo

Details for d3r23b2

PDB Entry: 3r23 (more details), 2.5 Å

PDB Description: Crystal Structure of D-alanine--D-Alanine Ligase from Bacillus anthracis
PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d3r23b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r23b2 c.30.1.2 (B:0-93) D-Ala-D-Ala ligase, N-domain {Bacillus anthracis [TaxId: 198094]}
amrigvimggvssekqvsimtgnemianldknkyeivpitlnekmdliekakdidfalla
lhgkygedgtvqgtleslgipysgsnmlssgicm

SCOPe Domain Coordinates for d3r23b2:

Click to download the PDB-style file with coordinates for d3r23b2.
(The format of our PDB-style files is described here.)

Timeline for d3r23b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3r23b1