Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) |
Family d.31.1.1: Cdc48 domain 2-like [54586] (4 proteins) |
Protein Membrane fusion atpase p97 domain 2, P97-Nc [64254] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [233318] (6 PDB entries) |
Domain d3qq8a2: 3qq8 A:107-186 [239645] Other proteins in same PDB: d3qq8a1, d3qq8b_ automated match to d3qq7a2 complexed with cl |
PDB Entry: 3qq8 (more details), 2 Å
SCOPe Domain Sequences for d3qq8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qq8a2 d.31.1.1 (A:107-186) Membrane fusion atpase p97 domain 2, P97-Nc {Human (Homo sapiens) [TaxId: 9606]} dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvv etdpspycivapdtvihceg
Timeline for d3qq8a2: