Lineage for d3pvwa2 (3pvw A:186-549)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2543768Protein G-protein coupled receptor kinase 2 [90034] (1 species)
    AGC group; GRKs subfamily; serine/threonine kinase
  7. 2543769Species Cow (Bos taurus) [TaxId:9913] [90035] (10 PDB entries)
  8. 2543772Domain d3pvwa2: 3pvw A:186-549 [239629]
    Other proteins in same PDB: d3pvwa1, d3pvwa3, d3pvwb_, d3pvwg_
    automated match to d1omwa3
    complexed with qrx

Details for d3pvwa2

PDB Entry: 3pvw (more details), 2.49 Å

PDB Description: Bovine GRK2 in complex with Gbetagamma subunits and a selective kinase inhibitor (CMPD103A)
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d3pvwa2:

Sequence, based on SEQRES records: (download)

>d3pvwa2 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]}
ltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalnerimlsl
vstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaaeiilgl
ehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymapevlqkg
vaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltmavelpdsfspelrsll
egllqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprgevnaadafdi
gsfdeedtkgiklldsdqelyrnfpltiserwqqevaetvfdtinaetdrlearkktknk
qlgh

Sequence, based on observed residues (ATOM records): (download)

>d3pvwa2 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]}
ltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalnerimlsl
vstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaaeiilgl
ehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymapevlqkg
vaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltmavelpdsfspelrsll
egllqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprgklldsdqely
rnfpltiserwqqevaetvfdtinaetdrlearkktknkqlgh

SCOPe Domain Coordinates for d3pvwa2:

Click to download the PDB-style file with coordinates for d3pvwa2.
(The format of our PDB-style files is described here.)

Timeline for d3pvwa2: