Lineage for d3pefb1 (3pef B:1-162)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2107670Species Geobacter metallireducens [TaxId:28232] [233232] (1 PDB entry)
  8. 2107672Domain d3pefb1: 3pef B:1-162 [239607]
    Other proteins in same PDB: d3pefa2, d3pefb2, d3pefc2, d3pefd2, d3pefe2, d3peff2, d3pefg2, d3pefh2
    automated match to d3pefa1
    complexed with edo, gol, nap, peg

Details for d3pefb1

PDB Entry: 3pef (more details), 2.07 Å

PDB Description: crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+
PDB Compounds: (B:) 6-phosphogluconate dehydrogenase, NAD-binding

SCOPe Domain Sequences for d3pefb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pefb1 c.2.1.0 (B:1-162) automated matches {Geobacter metallireducens [TaxId: 28232]}
sqkfgfiglgimgsamaknlvkagcsvtiwnrspekaeelaalgaeraatpcevvescpv
tfamladpaaaeevcfgkhgvlegigegrgyvdmstvdpatsqrigvavvakggrfleap
vsgskkpaedgtliilaagdrnlydeampgfekmgkkiihlg

SCOPe Domain Coordinates for d3pefb1:

Click to download the PDB-style file with coordinates for d3pefb1.
(The format of our PDB-style files is described here.)

Timeline for d3pefb1: