SCOPe 2.04: Domain d3pduh1: 3pdu H:2-163

Lineage for d3pduh1 (3pdu H:2-163)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (181 species)
   not a true protein

7. Species Geobacter sulfurreducens [TaxId:35554] [233218] (1 PDB entry)

8. Domain d3pduh1: 3pdu H:2-163 [239605]
   Other proteins in same PDB: d3pdua2, d3pdub2, d3pduc2, d3pdud2, d3pdue2, d3pduf2, d3pdug2, d3pduh2
   automated match to d3pduc1
   complexed with gol, nap

Details for d3pduh1

PDB Entry: 3pdu, 1.89 Å

PDB Description: crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+

PDB Compounds: (H:) 3-hydroxyisobutyrate dehydrogenase family protein

SCOPe Domain Sequences for d3pduh1:

Sequence; same for both SEQRES and ATOM records:

>d3pduh1 c.2.1.0 (H:2-163) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
ttygflglgimggpmaanlvragfdvtvwnrnpakcaplvalgarqasspaevcaacdit
iamladpaaarevcfgangvlegigggrgyidmstvddetstaigaavtarggrfleapv
sgtkkpaedgtliilaagdqslftdagpafaalgkkclhlge

Timeline for d3pduh1:

• d3pduh1 is new in SCOPe 2.04-stable
  
• d3pduh1 appears in SCOPe 2.05
  
• d3pduh1 appears in the current release, SCOPe 2.08