SCOPe 2.04: Domain d3oojd1: 3ooj D:1-235

Lineage for d3oojd1 (3ooj D:1-235)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.0: automated matches [191393] (1 protein)
   not a true family

6. Protein automated matches [190509] (9 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [233107] (2 PDB entries)

8. Domain d3oojd1: 3ooj D:1-235 [239583]
   Other proteins in same PDB: d3ooja2, d3oojb2, d3oojc2, d3oojd2, d3ooje2, d3oojf2, d3oojg2, d3oojh2
   automated match to d3oojb1
   complexed with g6p, g6q, glu, gol; mutant

Details for d3oojd1

PDB Entry: 3ooj, 2.5 Å

PDB Description: c1a mutant of e. coli glms in complex with glucose-6p and glutamate

PDB Compounds: (D:) Glucosamine/fructose-6-phosphate aminotransferase, isomerizing

SCOPe Domain Sequences for d3oojd1:

Sequence; same for both SEQRES and ATOM records:

>d3oojd1 d.153.1.0 (D:1-235) automated matches {Escherichia coli [TaxId: 562]}
agivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdie

Timeline for d3oojd1:

• d3oojd1 is new in SCOPe 2.04-stable
  
• d3oojd1 appears in SCOPe 2.05
  
• d3oojd1 appears in the current release, SCOPe 2.08