Lineage for d3omnd2 (3omn D:130-281)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2043106Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2043107Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2043698Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 2043837Protein automated matches [233094] (2 species)
    not a true protein
  7. 2043843Species Rhodobacter sphaeroides [TaxId:272943] [233095] (4 PDB entries)
  8. 2043845Domain d3omnd2: 3omn D:130-281 [239582]
    Other proteins in same PDB: d3omna_, d3omnb1, d3omnb3, d3omnc_, d3omnd1, d3omnd3
    automated match to d3om3d2
    complexed with ca, cd, cl, cu1, dmu, hea, hth, mg, oh, trd; mutant

Details for d3omnd2

PDB Entry: 3omn (more details), 2.15 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with d132a mutation in the reduced state
PDB Compounds: (D:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3omnd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3omnd2 b.6.1.2 (D:130-281) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde
fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff
gqcselcgishaympitvkvvseeayaawleq

SCOPe Domain Coordinates for d3omnd2:

Click to download the PDB-style file with coordinates for d3omnd2.
(The format of our PDB-style files is described here.)

Timeline for d3omnd2: