Lineage for d3omnb2 (3omn B:130-285)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1774126Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1774127Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1774690Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 1774801Protein automated matches [233094] (2 species)
    not a true protein
  7. 1774805Species Rhodobacter sphaeroides [TaxId:272943] [233095] (4 PDB entries)
  8. 1774806Domain d3omnb2: 3omn B:130-285 [239580]
    Other proteins in same PDB: d3omna_, d3omnb1, d3omnc_, d3omnd1
    automated match to d3om3d2
    complexed with ca, cd, cl, cu1, dmu, hea, hth, mg, oh, trd; mutant

Details for d3omnb2

PDB Entry: 3omn (more details), 2.15 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with d132a mutation in the reduced state
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3omnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3omnb2 b.6.1.2 (B:130-285) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde
fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff
gqcselcgishaympitvkvvseeayaawleqhhhh

SCOPe Domain Coordinates for d3omnb2:

Click to download the PDB-style file with coordinates for d3omnb2.
(The format of our PDB-style files is described here.)

Timeline for d3omnb2: