SCOPe 2.04: Domain d3omid2: 3omi D:130-285

Lineage for d3omid2 (3omi D:130-285)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein automated matches [233094] (2 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:272943] [233095] (4 PDB entries)

8. Domain d3omid2: 3omi D:130-285 [239578]
   Other proteins in same PDB: d3omia_, d3omib1, d3omic_, d3omid1
   automated match to d3om3d2
   complexed with ca, cd, cl, cu, cu1, dmu, fe, hea, hth, mg, oh, trd; mutant

Details for d3omid2

PDB Entry: 3omi, 2.15 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with d132a mutation

PDB Compounds: (D:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3omid2:

Sequence; same for both SEQRES and ATOM records:

>d3omid2 b.6.1.2 (D:130-285) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde
fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff
gqcselcgishaympitvkvvseeayaawleqhhhh

Timeline for d3omid2:

• d3omid2 is new in SCOPe 2.04-stable
  
• d3omid2 appears in SCOPe 2.05
  
• d3omid2 appears in the current release, SCOPe 2.08