Lineage for d3omid1 (3omi D:30-129)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629297Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2629435Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 2629436Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 2629576Protein automated matches [233090] (1 species)
    not a true protein
  7. 2629577Species Rhodobacter sphaeroides [TaxId:272943] [233091] (6 PDB entries)
  8. 2629583Domain d3omid1: 3omi D:30-129 [239577]
    Other proteins in same PDB: d3omia_, d3omib2, d3omib3, d3omic_, d3omid2, d3omid3
    automated match to d3om3d1
    complexed with ca, cd, cl, cu, cu1, dmu, hea, hth, mg, oh, trd; mutant

Details for d3omid1

PDB Entry: 3omi (more details), 2.15 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with d132a mutation
PDB Compounds: (D:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3omid1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3omid1 f.17.2.1 (D:30-129) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
vparfthnspleiawtivpivilvaigafslpvlfnqqei

SCOPe Domain Coordinates for d3omid1:

Click to download the PDB-style file with coordinates for d3omid1.
(The format of our PDB-style files is described here.)

Timeline for d3omid1: