| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) ![]() |
| Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins) |
| Protein automated matches [233090] (1 species) not a true protein |
| Species Rhodobacter sphaeroides [TaxId:272943] [233091] (6 PDB entries) |
| Domain d3omid1: 3omi D:30-129 [239577] Other proteins in same PDB: d3omia_, d3omib2, d3omib3, d3omic_, d3omid2, d3omid3 automated match to d3om3d1 complexed with ca, cd, cl, cu, cu1, dmu, hea, hth, mg, oh, trd; mutant |
PDB Entry: 3omi (more details), 2.15 Å
SCOPe Domain Sequences for d3omid1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3omid1 f.17.2.1 (D:30-129) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
vparfthnspleiawtivpivilvaigafslpvlfnqqei
Timeline for d3omid1: